PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI05G20390.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 593aa    MW: 65418.6 Da    PI: 8.2659
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI05G20390.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.82.1e-1755101148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT+eEde+l +av  + g++Wk+Ia+ +   Rt+ qc +rwqk+l
  ORUFI05G20390.1  55 KGGWTPEEDEKLRKAVDIYNGKNWKKIAESFS-DRTEVQCLHRWQKVL 101
                      688*****************************.************986 PP

2Myb_DNA-binding59.29.3e-19107153148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+eEd+ +++ vk++G++ W+ Iar ++ gR +kqc++rw+++l
  ORUFI05G20390.1 107 KGPWTQEEDDVIINMVKKHGPKKWSVIARSLN-GRIGKQCRERWHNHL 153
                      79******************************.*************97 PP

3Myb_DNA-binding51.32.7e-16159202146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      + +WT eE+  l++a+ ++G++ W+ Ia+ ++ gRt++++k++w++
  ORUFI05G20390.1 159 KEAWTVEEERVLARAHCMYGNK-WAEIAKLLP-GRTDNSIKNHWNS 202
                      579*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.29450101IPR017930Myb domain
SMARTSM007175.8E-1554103IPR001005SANT/Myb domain
PfamPF002493.0E-1555101IPR001005SANT/Myb domain
SuperFamilySSF466894.02E-1656111IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-2257109IPR009057Homeodomain-like
CDDcd001675.01E-1458101No hitNo description
PROSITE profilePS5129430.661102157IPR017930Myb domain
SuperFamilySSF466892.1E-31104200IPR009057Homeodomain-like
SMARTSM007174.1E-17106155IPR001005SANT/Myb domain
PfamPF002496.8E-17107153IPR001005SANT/Myb domain
CDDcd001671.16E-15109153No hitNo description
Gene3DG3DSA:1.10.10.601.5E-25110156IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.9E-22157208IPR009057Homeodomain-like
SMARTSM007171.3E-14158206IPR001005SANT/Myb domain
PROSITE profilePS5129421.856158208IPR017930Myb domain
PfamPF002497.0E-15159202IPR001005SANT/Myb domain
CDDcd001671.05E-11161204No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 593 aa     Download sequence    Send to blast
MPAVKVEEEE EERNPVASSP SVSEGSAHAA ALASPTAADS IFGRRRKSGP VRRAKGGWTP  60
EEDEKLRKAV DIYNGKNWKK IAESFSDRTE VQCLHRWQKV LDPELIKGPW TQEEDDVIIN  120
MVKKHGPKKW SVIARSLNGR IGKQCRERWH NHLDPQIRKE AWTVEEERVL ARAHCMYGNK  180
WAEIAKLLPG RTDNSIKNHW NSSLRKKIDD YNTRDILPVH PPVVGDGLKQ LPKRPPADNH  240
FDLNKEPIIC SRDRLGVVHS DPTSHQRASN LKDFKGCADY LSLGQPVTSC EASAADDSAF  300
DLATQGMRMD SVHDKGTGNN FVCGKVQGIN FLGDKGLKIN QISDKMGCSR QAKREGEAAI  360
NGGGSSLQSE AHSVGSLCYQ IPKMEDIAPA QSPVFTANYV PEHSRNVMHS PNGYTTPPTH  420
GKGSDQLSVE SILRSAAEKF HGTPSILRRR KRDKPTPAED NDLKIGRLSS DDFHTPIGKC  480
TTDSPQSFKT AALLSLGPMD EQGSLDVSPP YRLRSKRLAV LKTVQNHLDF SSDEMSICDT  540
TMKSACGNSD CANASSGVSS IQGKKLDEHM IGLETLTMNF AHTTKLDATQ PNL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C2e-69542085159MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-69542085159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1447454RRRKRDKP
2448453RRKRDK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00482DAPTransfer from AT5G02320Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1067560.0AK106756.1 Oryza sativa Japonica Group cDNA clone:002-115-D07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015637435.10.0PREDICTED: uncharacterized protein LOC4339005
TrEMBLA0A0E0PNI70.0A0A0E0PNI7_ORYRU; Uncharacterized protein
TrEMBLB9FJH50.0B9FJH5_ORYSJ; Uncharacterized protein
STRINGBGIOSGA017917-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30993880
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.21e-102myb domain protein 3r-5